PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000154734
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 233aa    MW: 26697.1 Da    PI: 9.3995
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000154734genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY34.73.5e-11142163122
                    ---SS-EEEEEEE--TT-SS-E CS
           WRKY   1 ldDgynWrKYGqKevkgsefpr 22 
                    ldDgy+WrKYGqK vk ++fpr
  MDP0000154734 142 LDDGYRWRKYGQKAVKANKFPR 163
                    59*******************9 PP

2WRKY57.82.2e-181712121859
                    -SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY  18 sefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +++rsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H+h+
  MDP0000154734 171 GNCTRSYYRCTYQGCNVKKQVQRLNKDEGIVVTTYEGMHTHP 212
                    5789*************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.8E-31127212IPR003657WRKY domain
SuperFamilySSF1182903.92E-24134213IPR003657WRKY domain
PROSITE profilePS5081124.42137214IPR003657WRKY domain
SMARTSM007743.4E-36142213IPR003657WRKY domain
PfamPF031063.3E-7143163IPR003657WRKY domain
PfamPF031062.4E-14171212IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEKYQMFFPC SSSANYPNPN SXNTDHHHMG SSHVYTNNFD GRVDQTSDGL LRLSSTTKTE  60
DXVGSSSGEV LVHKDGHPYQ QYYQQYYPSA NASMNNIVVG GDQSSVDPHR ANNNYSEKKK  120
KGEKKMKKPK YAFQTRSQVD VLDDGYRWRK YGQKAVKANK FPRFAPVLSS GNCTRSYYRC  180
TYQGCNVKKQ VQRLNKDEGI VVTTYEGMHT HPIDKPSDNF EHILSQMQIY THI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-23132213776Probable WRKY transcription factor 4
2lex_A5e-23132213776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008379098.11e-137PREDICTED: probable WRKY transcription factor 75
TrEMBLM5WY442e-91M5WY44_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s33560.12e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.14e-50WRKY DNA-binding protein 75